SMART: PDB domain 1kl7

The domain within your query sequence starts at position 2 and ends at position 158; the E-value for the 1kl7 domain shown below is 2e-27.

MGIPIRKFICASNQNHVLTDFIKTGHYDLRNRKLAQTFSPSIDILKSSNLERHLYLMANK
DGQLMANLYHQLESQLHFRIEKMLVEKLQQEFVADWCSEGECLAAISTTYNASGYILDPH
TAVAKVVADKMQDKSCPVLIASTAHYSKFAPAIMQAL

The domain within your query sequence starts at position 2 and ends at position 158; the E-value for the 1kl7 domain shown below is 2e-27.

This is a PDB domain - please see the PDBSUM entry of 1kl7 for further annotation